PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G396500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 189aa    MW: 21626 Da    PI: 9.6235
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G396500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.55.6e-072966338
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlk 38
                        +W++ Ed+ +  a  +++ g   +W+++a+ ++ gRt+ 
  Sevir.5G396500.1.p 29 PWSKAEDKVFESALVMWPEGapdRWALVAAQLP-GRTPR 66
                        8********************************.***86 PP

2Myb_DNA-binding44.92.7e-14121165347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ l++++ +++G g+W+ I+r    +Rt+ q+ s+ qky
  Sevir.5G396500.1.p 121 AWTEEEHRLFLQGLERYGRGDWRNISRFSVRTRTPAQVASHAQKY 165
                         6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.1562280IPR017930Myb domain
SMARTSM007178.2E-42678IPR001005SANT/Myb domain
SuperFamilySSF466893.88E-102875IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-52873IPR009057Homeodomain-like
PfamPF002491.1E-52966IPR001005SANT/Myb domain
CDDcd001671.22E-42967No hitNo description
PROSITE profilePS5129418.743114170IPR017930Myb domain
SuperFamilySSF466893.09E-17115168IPR009057Homeodomain-like
SMARTSM007171.4E-10118168IPR001005SANT/Myb domain
TIGRFAMsTIGR015578.9E-17119168IPR006447Myb domain, plants
PfamPF002491.2E-11121165IPR001005SANT/Myb domain
CDDcd001674.51E-11121166No hitNo description
Gene3DG3DSA:1.10.10.601.3E-11121170IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MDFQHQHQHQ HHHHRSVLAA GPPEVAVRPW SKAEDKVFES ALVMWPEGAP DRWALVAAQL  60
PGRTPREAWE HYEALVADVD LIERGAVDVP TSWDDDDDAG GPTRRPGANR ARREPRRTGI  120
AWTEEEHRLF LQGLERYGRG DWRNISRFSV RTRTPAQVAS HAQKYFNRRL NPASRDSKRK  180
SIHDITTP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-152891972RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970674.11e-123PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-44DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3XMC41e-123K3XMC4_SETIT; Uncharacterized protein
STRINGSi003047m1e-123(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-47MYB family protein